Gráfico Cascata, Bridge ou Waterfall

O gráfico em Cascata, Bridge ou Waterfall é bastante utilizado na época do orçamento. Seguem três formas de fazer

1 – Versões mais recentes do Excel têm um gráfico desses nativo, em Inserir -> Gráficos -> Cascata.

Só tem um truque adicional. Para definir quais colunas são de total, e não para somar e subtrair: selecionar apenas a coluna que queremos, clicar com botão direito e marcar a opção “Definir como total”.

  1. Para versões anteriores do Excel, segue um template em anexo.

Essencialmente, é um gráfico em barras empilhadas, com a primeira pilha transparente.

Basta preencher as células amarelas. É possível eliminar ou expandir colunas, seguindo a mesma fórmula.

Outra dica é pintar os negativos de vermelho (manualmente).

Opção 3: Google Sheets

Também é muito simples.

É necessário ter uma conta no Google, e acessar Google Sheets. É um clone de Excel, mas do Google, e em clound.

Para criar o gráfico, basta inserir os dados, depois Insert -> Chart. Escolher o Waterfall chart.

https://docs.google.com/spreadsheets/d/1Qj83YL_bGZVdanNVHn3WIvvTbefyZ6uT1KmksS67O6E/edit?usp=sharing

Outras sugestões, fiquem à vontade para contribuir.

Como (não) fraudar dados e falar sobre honestidade

Dan Ariely é um palestrante internacionalmente conhecido, autor de best seller sobre economia comportamental, figura carimbada em TED talks e tem até série na Netflix. Há alguns dias, pesquisadores investigativos publicaram evidências fortes de que um de seus estudos é fruto de fraude.

Como o autor de “A (honesta) verdade sobre a desonestidade” pode ter ele mesmo fabricado dados e conclusões? Ele e os demais envolvidos afirmam que também não sabiam da manipulação.

Independente ou não de má fé, sua imagem fica extremamente arranhada.

Vale muito a pena entender a análise investigativa completa. Foi um trabalho de “Sherlock Holmes” de informação, publicado no blog Data Colada: https://datacolada.org/98

Segue um resumo:

  • A tese de Ariely é de que assinar formulários prometendo honestidade antes de preencher os dados faz as pessoas serem mais honestas do que assinar só no final.

  • Essa tese levou diversos governos e empresas a mudarem seus formulários. O…

Ver o post original 367 mais palavras

Classificador e SVM

Sobre o problema da reta para classificador.

Dados os pontos:

Performance =  [6.8, 7.9, 9.6, 9.6, 9.4, 7.9, 8.8, 7.9, 5.8, 7.8, 5.9, 6.7, 9.3, 7.9, 6.5, 7.8, 8.0, 6.3, 9.4, 7.4, 9.2, 9.5, 6.8, 5.5, 5.7, 6.2, 5.6, 6.6, 5.5, 5.5]

Dificuldade =  [8.0, 6.5, 8.4, 5.4, 7.2, 8.5, 8.5, 9.3, 9.3, 8.3, 9.6, 9.1, 8.9, 7.0, 9.1, 8.1, 9.2, 9.1, 6.5, 9.8, 8.9, 5.4, 5.9, 5.6, 5.5, 6.6, 5.4, 7.0, 5.9, 5.4]

Resultado =  [‘Ok’, ‘Ok’, ‘Ok’, ‘Ok’, ‘Ok’, ‘Ok’, ‘Ok’, ‘Ok’, ‘Ok’, ‘Ok’, ‘Ok’, ‘Ok’, ‘Ok’, ‘Ok’, ‘Ok’, ‘Ok’, ‘Ok’, ‘Ok’, ‘Ok’, ‘Ok’, ‘Ok’, ‘Ok’, ‘Não Ok’, ‘Não Ok’, ‘Não Ok’, ‘Não Ok’, ‘Não Ok’, ‘Não Ok’, ‘Não Ok’, ‘Não Ok’]

A forma mais simples é fazer no braço. Traçar uma linha no gráfico, ver onde intercepta nos eixos, e resolver o sisteminha de equações:

9 = a*5+b

5 = a*9 +b

Isso dá a reta x + y = 14.

Há várias retas possíveis que satisfazem a separação, e todas elas estão corretas.

Porém, dentre as inúmeras retas, qual a mais robusta?

Dentre as técnica possíveis para resolver a questão, tem uma chamada SVM (Support vector machine).

Intuitivamente, esta técnica maximiza a margem entre as duas classes, sendo assim melhor das retas possíveis nesse sentido. A margem é a distância entre paralelas do separador (vide Máquina de vetores de suporte – Wikipédia, a enciclopédia livre (wikipedia.org))

No Python, o SVM já vem pronto:

from sklearn import svm

clf = svm.SVC(kernel = ‘linear’) #Classificador linear

#Faz fit entre dados e resultado

clf.fit(X, Y)

#Predizer uma combinação

print(clf.predict([[7.5, 7]])) #Resposta = 1, classificado

Vide o código deste exercício em:

https://colab.research.google.com/drive/1yZUYTwDq0o7OtN94Hwg4t3_NNi4fNaon?usp=sharing

Para classificador, é possível também usar árvores de decisão, redes neurais – fica para o próximo exercício.

Ideias Analíticas Avançadas

Um mundo mais eficaz através do Analytics

https://ideiasesquecidas.com/

Sobre DNA, AlphaFold e um pequeno exercício (continuação)

Algumas respostas deste exercício.

A função “Localizar” do Excel faz o match perfeito. Ela precisa de dois parâmetros: O QUE quero procurar (no caso, LEDATL), e ONDE quero procurar (na string MEQDRDIYFMQLA….)

O resultado vai ser o número 73, o que indica que a string foi encontrada na posição 73 da string maior.

Agora, num match imperfeito, não vai dar certo. Vai retornar #VALOR!.

O match imperfeito é um problema bem mais complicado, porque há várias possibilidades, como trocar um caractere, um caractere sumir ou surgir.

Os algoritmos existentes testam várias possiblidades e retornam o grau de acurácia do match.

Há uma forma de representar visualmente um match imperfeito. Colocar uma string na linha, outra na coluna, fazer matches perfeitos e verificar as diagonais.

O arquivo aqui (https://1drv.ms/x/s!Aumr1P3FaK7jnzdHbdMDEjEhhJG0) ilustra o exemplo.

Esse método criativo é baseado no livro “Protein bioinformatics”. Foto mostrando a técnica:

Ideias Analíticas Avançadas

Um mundo mais eficaz através do Analytics

Sobre DNA, AlphaFold e um pequeno exercício

Se um computador tem a codificação em zeros e uns, um ser humano é codificado com 4 moléculas: Adenina, Guanina, Citosina e Timina. É o livro de códigos conhecido como DNA.

Assim como um código de computador, tem instruções específicas para começar, parar e identificar o que deve ser feito.

Esse código DNA vira uma proteína no final das contas, que vira algo útil para o ser humano, como um anticorpo.

Hoje em dia, sequenciar DNA é um problema fácil. Porém, prever a estrutura final da proteína é um problema muito difícil — é uma estrutura em 3D, onde cada moleculazinha interfere em todas as outras.

Por ser um problema muito difícil e importante, é um prato cheio para as empresas de IA mais avançadas do mundo.

A empresa DeepMind, da Google, desenvolveu um algoritmo chamado AlphaFold, que prevê o dobramento da proteína a partir do sequenciamento. A DeepMind desenvolve o que há de mais avançado em IA no mundo. Só para ter uma ideia, para treinar um algoritmo desses é na ordem de alguns milhões de dólares.

Agora o DeepMind anunciou que vai tornar todo esse conhecimento público.

DeepMind vai liberar estruturas de todas as proteínas conhecidasEm dezembro de 2020, a DeepMind, braço de inteligência artificial do Google, pegou o mundo da biologia de surpresa ao…www.tecmundo.com.br

“Até agora, o banco de dados consiste em 350.000 novas estruturas de proteínas. A DeepMind diz que vai prever e liberar as estruturas de mais de 100 milhões delas nos próximos meses — mais ou menos todas as proteínas conhecidas pela ciência.” — Trecho da matéria.

Aplicações potenciais: desenvolver novos remédios, conhecer melhor moléculas do corpo humano, etc.

Exercício simples com o genoma da COVID

O genoma da COVID pode ser baixado no site a seguir.
https://www.ncbi.nlm.nih.gov/sars-cov-2/

Esse compartilhamento de informações é o que possibilitou o desenvolvimento de vacinas num tempo tão curto.

São informações como a seguinte. Peguei um pequeno trecho, a base toda tem centenas de megabytes de tamanho.

Exercício: dada uma sequência genética como a seguinte,

MEQDRDIYFMQLAIEEAKKAEEMQEVPIGAVIVLDGEVISVAHNLRETEQRSIAHAELLAIDEACKKLGTWRLEDATLYVTLEPCPMCAGGIVLSRVKRVVYGASDPKGGCAGTLMNLLTDERFNHQCEVVTGVLEEECGTLLTNFFRELRKKRKAIKKLEKSNEN

Encontre o trecho a seguir. Está em qual posição?

LEDATL

Dica: No Excel, é só usar a função “Localizar”.

Agora, para pensar. Digamos que haja uma pequena mutação em uma das posições.

LADATL

O match perfeito agora não vai dar certo. Como encontrar o match mais similar possível?

Só para saber, o match similar é um problema bem mais difícil e há vários algoritmos propostos para tal.

Ideias analíticas avançadas:

https://medium.com/ideias-anal%C3%ADticas-avan%C3%A7adas

Como escolher exatamente a cor do logo da empresa no ppt?

Esta é uma dica principalmente para apresentações.

Digamos que eu queira pintar um shape qualquer com a mesma cor do logotipo da Klabin. Como fazer?

Uma solução simples é usar a ferramenta conta-gotas. Selecionar o shape, e ir em Formatar -> Preenchimento da forma – Conta-gotas.

Com o conta-gotas, escolher a cor desejada.

Resultado:

Outra dica de cores é usar o Adobe colors.

https://color.adobe.com/pt/create/color-wheela

Pelo disco de cores, podemos escolher uma cor, e uma regra de harmonia entre cores.

Há várias regras possíveis – eu gosto da complementar:

Como usar a cor escolhida no ppt?

Debaixo das cores, tem o número delas em RGB. Podemos usar esse número. Digamos o primeiro roxo, R = 134, G = 20, B = 163

No Power Point, em Preenchimento -> Mais cores de preenchimento

Preenchendo o código RGB, o shape terá a cor indicada.

Dessa forma, poderemos ter cores agradáveis em nossas apresentações!

Att

Ocultar colunas – VBA

Digamos que eu tenha um dashboard, como o seguinte.

O objetivo é criar uma rotina para mostrar somente as telas que forem clicadas e ocultar as demais.

Ex. Clico no botão “Tela 2”, e a rotina mostra apenas a Tela 2:

Outro exemplo. Clico no botão “Tela 1”, e somente a Tela 1 é mostrada.

1 – Via VBA

Via código, para ocultar as colunas de B a G, é só fazer:

    Columns(“B:G”).EntireColumn.Hidden = True

Para mostrar as colunas de B a G, utilizar False

    Columns(“B:G”).EntireColumn.Hidden = False

E é só adaptar essa lógica para cada caso.

2 – Via agrupar e desagrupar:

Esta é uma funcionalidade 100% Excel, sem código. Selecionar as colunas e via Dados -> Agrupar, vão aparecer uns sinais de + e –, fazendo exatamente a funcionalidade desejada.

Planilha para download: https://1drv.ms/x/s!Aumr1P3FaK7jnzUjn1FYUsDRf6kV

Bônus: O Bingo da AI.

Ideias Analíticas Avançadas

Um mundo mais eficaz através do Analytics

Nova guia (medium.com)

O Trello-Excel

Trello é um painel onde podemos visualizar e mover tarefas. É uma ferramenta bacana .

Em Excel, dá para fazer algo do tipo, e ainda fazer link com dados na planilha! Seria um “Trellocel”, ou “ExTrello”.

O primeiro passo é inserir um shape.

Clicar no shape, e na barra de fórmulas, referenciar a célula (no caso, B4).

É possível mudar cores, formatações gerais, etc.

Um coisa legal também é estar linkado com os dados da planilha. Mudando a mesma, o texto do shape muda também.

Link para download: https://1drv.ms/x/s!Aumr1P3FaK7jnyv4ez06CbntIszv?e=ey7WAY


Ideias Analíticas Avançadas
Um mundo melhor através do Analytics

Ideias Analíticas Avançadas

Estou lançando uma publicação na plataforma Medium: a Ideias Analíticas Avançadas (https://medium.com/ideias-anal%C3%ADticas-avan%C3%A7adas).

Os objetivos são:

  • Escrever sobre Analytics Hard: Otimização, Matemática, Python, Computação Quântica, com código e tudo
  • Convidar outros autores a publicar sobre o tema.

Fica já o convite, quem quiser escrever sobre alguns dos temas e divulgar ali.

Macro para salvar Excel em TXT

Segue uma macro que pode ser útil, para salvar dados de Excel para TXT.

Uma aplicação é enviar informação para outro sistema, por exemplo.

O Excel tem nativamente uma opção de salvar como CSV, porém, o uso de macros permite uma flexibilidade enorme, além de todo o poder de processar a informação da forma que quisermos.

Imagine que a planilha seja como a abaixo.

Queremos salvar o arquivo com o nome indicado na célula C2, no mesmo diretório em que o arquivo Excel se encontra.

O código vai contar as linhas, jogar o conteúdo para a memória.

A seguir, vai criar o arquivo texto, escrever nele e fechar:

‘Inicializa funcao de manipulação de arquivos

Set fs = CreateObject(“Scripting.FileSystemObject”)

strPath = ThisWorkbook.Path & “\” & nomeArquivo

Set afs = fs.CreateTextFile(strPath, 1, 0)

‘Escreve conteúdo

For i = 1 To nl

    strAux = “”

    For j = 1 To UBound(edados, 2)

        strAux = strAux & edados(i, j) & “, “

    Next j

    ‘escreve no arquivo

    afs.writeline strAux

Next i

‘Fecha o arquivo

afs.Close

Set afs = Nothing

Set fs = Nothing

Resultado:

Vide arquivo para download: https://1drv.ms/x/s!Aumr1P3FaK7jnyUz0c1mYGji8DgR


Ideias Analíticas Avançadas

https://medium.com/ideias-anal%C3%ADticas-avan%C3%A7adas

Um mundo mais eficaz através do Analytics